Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292), Unconjugated, E. coli

Catalog Number: BIM-RPC27573
Article Name: Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27573
Supplier Catalog Number: RPC27573
Alternative Catalog Number: BIM-RPC27573-20UG,BIM-RPC27573-100UG,BIM-RPC27573-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: CLOST_2292Ferredoxin
Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654) (Clostridium sticklandii). Target Name: CLOST_2292. Target Synonyms: CLOST_2292Ferredoxin. Accession Number: P80168. Expression Region: 2~56aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 13.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 13.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AYVINDSCISCGACEPECPVNAITAGDDKYVIDAATCIDCGACAGVCPVDAPQPE
Target: CLOST_2292