Recombinant Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein, Unconjugated, E. coli

Catalog Number: BIM-RPC27574
Article Name: Recombinant Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27574
Supplier Catalog Number: RPC27574
Alternative Catalog Number: BIM-RPC27574-20UG,BIM-RPC27574-100UG,BIM-RPC27574-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: E3-19KE3gp 19 kDaE19GP19K
Recombinant Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2). Target Name: Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein. Target Synonyms: E3-19KE3gp 19 kDaE19GP19K. Accession Number: P68978. Expression Region: 18~123aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 20.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AKKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQKCLENTG
Target: Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein