Recombinant Mycoplasma pneumoniae Protein P200 (p200), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27575
Article Name: Recombinant Mycoplasma pneumoniae Protein P200 (p200), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27575
Supplier Catalog Number: RPC27575
Alternative Catalog Number: BIM-RPC27575-20UG,BIM-RPC27575-100UG,BIM-RPC27575-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: p200, MPN_567, MP275, Protein P200
Recombinant Mycoplasma pneumoniae Protein P200 (p200), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Target Name: p200. Target Synonyms: p200, MPN_567, MP275, Protein P200. Accession Number: P75211. Expression Region: 857~985aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LDWELLIGNSNYGHYEPSGEWVWAGYFDDNQIWTPDASVEWARESDYTDLIGDEIYGRYNRKGEWIWYGYYDETGEWVLVDEHYQNHQPRISEAPRFWEQLIGNEDYGYYEDNEWKWYDGEFDSEGNWL
Target: p200