Recombinant Viscum album Chitin-binding lectin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Viscum album (European mistletoe). Target Name: Viscum album Chitin-binding lectin. Accession Number: P81859. Expression Region: 1~49aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 32.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight:
32.1kDa
Tag:
N-Terminal Gst-Tagged
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity:
>85% by SDS-PAGE
Sequence:
IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL
Target:
Viscum album Chitin-binding lectin
* VAT and and shipping costs not included. Errors and price changes excepted