Recombinant Bothrops leucurus Snake venom metalloproteinase leucurolysin-A, Unconjugated, E. coli

Catalog Number: BIM-RPC27582
Article Name: Recombinant Bothrops leucurus Snake venom metalloproteinase leucurolysin-A, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27582
Supplier Catalog Number: RPC27582
Alternative Catalog Number: BIM-RPC27582-20UG,BIM-RPC27582-100UG,BIM-RPC27582-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Leuc-A (SVMP)
Recombinant Bothrops leucurus Snake venom metalloproteinase leucurolysin-A is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bothrops leucurus (Whitetail lancehead). Target Name: Bothrops leucurus Snake venom metalloproteinase leucurolysin-A. Target Synonyms: Leuc-A (SVMP). Accession Number: P84907. Expression Region: 1~202aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIFLDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP
Target: Bothrops leucurus Snake venom metalloproteinase leucurolysin-A