Recombinant Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA (aiiA), Unconjugated, E. coli

Catalog Number: BIM-RPC27590
Article Name: Recombinant Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA (aiiA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27590
Supplier Catalog Number: RPC27590
Alternative Catalog Number: BIM-RPC27590-20UG,BIM-RPC27590-100UG,BIM-RPC27590-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: AHL-lactonase AiiA
Recombinant Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA (aiiA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. Kurstaki. Target Name: aiiA. Target Synonyms: AHL-lactonase AiiA. Accession Number: P0CJ63. Expression Region: 1~250aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 35.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Target: aiiA