Recombinant Human coronavirus 229E Spike glycoprotein (S), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27604
Article Name: Recombinant Human coronavirus 229E Spike glycoprotein (S), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27604
Supplier Catalog Number: RPC27604
Alternative Catalog Number: BIM-RPC27604-20UG,BIM-RPC27604-100UG,BIM-RPC27604-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: E2Peplomer protein
Recombinant Human coronavirus 229E Spike glycoprotein (S), partial is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human coronavirus 229E (HCoV-229E). Target Name: S. Target Synonyms: E2Peplomer protein. Accession Number: P15423. Expression Region: 785~873aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.2kDa. Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Purity: >85% by SDS-PAGE
Form: Lyophilized powder
Sequence: DVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSL, NHLTSQLRQNFQAISSSIQAIYDRLDTIQ
Target: S