Recombinant Human coronavirus 229E Nucleoprotein (N), Unconjugated, E. coli

Catalog Number: BIM-RPC27607
Article Name: Recombinant Human coronavirus 229E Nucleoprotein (N), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27607
Supplier Catalog Number: RPC27607
Alternative Catalog Number: BIM-RPC27607-20UG,BIM-RPC27607-100UG,BIM-RPC27607-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Nucleocapsid protein, NC, Protein N
Recombinant Human coronavirus 229E Nucleoprotein (N) is a purified Recombinant Protein, Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human coronavirus 229E (HCoV-229E). Target Name: N. Target Synonyms: Nucleocapsid protein, NC, Protein N. Accession Number: P15130. Expression Region: 1~389aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 44.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.4kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPND
Target: N