Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated, Unconjugated, E. coli

Catalog Number: BIM-RPC27611
Article Name: Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27611
Supplier Catalog Number: RPC27611
Alternative Catalog Number: BIM-RPC27611-20UG,BIM-RPC27611-100UG,BIM-RPC27611-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: IL-11
Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: MOV-Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Target Name: Il11. Target Synonyms: IL-11. Accession Number: P20808. Expression Region: 22~199aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 67.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 67.2kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Target: Il11