Recombinant Dictyostelium discoideum Nucleoside diphosphate kinase, cytosolic (ndkC-1), Unconjugated, E. coli

Catalog Number: BIM-RPC27616
Article Name: Recombinant Dictyostelium discoideum Nucleoside diphosphate kinase, cytosolic (ndkC-1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27616
Supplier Catalog Number: RPC27616
Alternative Catalog Number: BIM-RPC27616-20UG,BIM-RPC27616-100UG,BIM-RPC27616-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Other
Conjugation: Unconjugated
Alternative Names: NDK, NDP kinase
Recombinant Dictyostelium discoideum Nucleoside diphosphate kinase, cytosolic (ndkC-1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dictyostelium discoideum (Slime mold). Target Name: ndkC-1. Target Synonyms: NDK, NDP kinase. Accession Number: P22887. Expression Region: 1~155aa. Tag Info: N-Terminal 10Xhis-V5-Tagged. Theoretical MW: 24.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.2kDa
Tag: N-Terminal 10Xhis-V5-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Target: ndkC-1