Recombinant Klebsiella pneumoniae Beta-lactamase SHV-3 (bla), Unconjugated, E. coli

Catalog Number: BIM-RPC27618
Article Name: Recombinant Klebsiella pneumoniae Beta-lactamase SHV-3 (bla), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27618
Supplier Catalog Number: RPC27618
Alternative Catalog Number: BIM-RPC27618-20UG,BIM-RPC27618-100UG,BIM-RPC27618-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Recombinant Klebsiella pneumoniae Beta-lactamase SHV-3 (bla) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Klebsiella pneumoniae. Target Name: bla. Accession Number: P30896. Expression Region: 22~286aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.0kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQLQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGI
Target: bla