Recombinant Mouse Stefin-2 (Stfa2), Unconjugated, E. coli

Catalog Number: BIM-RPC27620
Article Name: Recombinant Mouse Stefin-2 (Stfa2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27620
Supplier Catalog Number: RPC27620
Alternative Catalog Number: BIM-RPC27620-20UG,BIM-RPC27620-100UG,BIM-RPC27620-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Stfa2, Stf-2, Stf2Stefin-2
Recombinant Mouse Stefin-2 (Stfa2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Stfa2. Target Synonyms: Stfa2, Stf-2, Stf2Stefin-2. Accession Number: P35174. Expression Region: 1~103aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTEYTRKIKGGLSEARPATSEIQEIADKVRPLLEEKTNEKYEKFKAIEYKVQVVQGLNYFIKMNVGRGCYLHINVLSGISSENDLELTGYQTNKAKNDELTYF
Target: Stfa2