Recombinant Clostridium kluyveri NAD-dependent 4-hydroxybutyrate dehydrogenase (4hbD), Unconjugated, E. coli

Catalog Number: BIM-RPC27623
Article Name: Recombinant Clostridium kluyveri NAD-dependent 4-hydroxybutyrate dehydrogenase (4hbD), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27623
Supplier Catalog Number: RPC27623
Alternative Catalog Number: BIM-RPC27623-20UG,BIM-RPC27623-100UG,BIM-RPC27623-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Recombinant Clostridium kluyveri NAD-dependent 4-hydroxybutyrate dehydrogenase (4hbD) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680). Target Name: 4hbD. Accession Number: P38945. Expression Region: 1~371aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 49.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MKLLKLAPDVYKFDTAEEFMKYFKVGKGDFILTNEFLYKPFLEKFNDGADAVFQEKYGLGEPSDEMINNIIKDIGDKQYNRIIAVGGGSVIDIAKILSLKYTDDSLDLFEGKVPLVKNKELIIVPTTCGTGSEVTNVSVAELKRRHTKKGIASDELYATYAVLVPEFIKGLPYKFFVTSSVDALIHATEAYVSPNANPYTDMFSVKAMELILNGYMQMVEKGNDYRVEIIEDFVIGSNYAGIAFGNAGVGAVHAL
Target: 4hbD