Recombinant Zea mays Endochitinase B (CHIB), Unconjugated, E. coli

Catalog Number: BIM-RPC27633
Article Name: Recombinant Zea mays Endochitinase B (CHIB), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27633
Supplier Catalog Number: RPC27633
Alternative Catalog Number: BIM-RPC27633-20UG,BIM-RPC27633-100UG,BIM-RPC27633-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Seed chitinase B
Recombinant Zea mays Endochitinase B (CHIB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zea mays (Maize). Target Name: Zea mays Endochitinase B (CHIB). Target Synonyms: Seed chitinase B. Accession Number: P29023. Expression Region: 21~269aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QNCGCQPNVCCSKFGYCGTTDEYCGDGCQSGPCRSGRGGGGSGGGGANVASVVTSSFFNGIKNQAGSGCEGKNFYTRSAFLSAVKGYPGFAHGGSQVQGKREIAAFFAHATHETGHFCYISEINKSNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAVVAFKAALWFWMNSVHGVVPQGFGATTRAMQRALECGGNNPAQMNARVGYYRQYCRQLGVDPGPNLTC
Target: Zea mays Endochitinase B (CHIB)