Recombinant Mouse Stefin-1 (Stfa1), Unconjugated, E. coli

Catalog Number: BIM-RPC27639
Article Name: Recombinant Mouse Stefin-1 (Stfa1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27639
Supplier Catalog Number: RPC27639
Alternative Catalog Number: BIM-RPC27639-20UG,BIM-RPC27639-100UG,BIM-RPC27639-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Stfa1, Stf-1, Stf1Stefin-1
Recombinant Mouse Stefin-1 (Stfa1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Stfa1. Target Synonyms: Stfa1, Stf-1, Stf1Stefin-1. Accession Number: P35175. Expression Region: 1~97aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF
Target: Stfa1