Recombinant Phleum pratense Pollen allergen Phl p 6 (PHLPVI), Unconjugated, E. coli

Catalog Number: BIM-RPC27641
Article Name: Recombinant Phleum pratense Pollen allergen Phl p 6 (PHLPVI), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27641
Supplier Catalog Number: RPC27641
Alternative Catalog Number: BIM-RPC27641-20UG,BIM-RPC27641-100UG,BIM-RPC27641-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Allergen Phl p VI, Phl p 6
Recombinant Phleum pratense Pollen allergen Phl p 6 (PHLPVI) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Phleum pratense (Common timothy). Target Name: PHLPVI. Target Synonyms: Allergen Phl p VI, Phl p 6. Accession Number: P43215. Expression Region: 23~132aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA
Target: PHLPVI