Recombinant Listeria monocytogenes serovar 1/2a Internalin-A (inlA), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27642
Article Name: Recombinant Listeria monocytogenes serovar 1/2a Internalin-A (inlA), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27642
Supplier Catalog Number: RPC27642
Alternative Catalog Number: BIM-RPC27642-20UG,BIM-RPC27642-100UG,BIM-RPC27642-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Recombinant Listeria monocytogenes serovar 1/2a Internalin-A (inlA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e). Target Name: inlA. Accession Number: P0DJM0. Expression Region: 32~414aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 49.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: NAQAATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQIS
Target: inlA