Recombinant Salmonella enteritidis Cold shock protein CspA (cspA), Unconjugated, E. coli

Catalog Number: BIM-RPC27671
Article Name: Recombinant Salmonella enteritidis Cold shock protein CspA (cspA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27671
Supplier Catalog Number: RPC27671
Alternative Catalog Number: BIM-RPC27671-20UG,BIM-RPC27671-100UG,BIM-RPC27671-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: 7.4 kDa cold shock proteinCS7.4
Recombinant Salmonella enteritidis Cold shock protein CspA (cspA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Salmonella enteritidis. Target Name: cspA. Target Synonyms: 7.4 kDa cold shock proteinCS7.4. Accession Number: P0A9Y5. Expression Region: 2~70aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 14.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 14.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL
Target: cspA