Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS), Unconjugated

Catalog Number: BIM-RPC27681
Article Name: Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS), Unconjugated
Biozol Catalog Number: BIM-RPC27681
Supplier Catalog Number: RPC27681
Alternative Catalog Number: BIM-RPC27681-20UG,BIM-RPC27681-100UG,BIM-RPC27681-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Probable L,D-transpeptidase YbiS(EC 2.-.-.-)
Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Target Name: ybiS. Target Synonyms: Probable L,D-transpeptidase YbiS(EC 2.-.-.-). Accession Number: P0AAX9. Expression Region: 25~306aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 38.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQT
Target: ybiS