Recombinant Naja atra Cytotoxin 2, Unconjugated, E. coli

Catalog Number: BIM-RPC27686
Article Name: Recombinant Naja atra Cytotoxin 2, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27686
Supplier Catalog Number: RPC27686
Alternative Catalog Number: BIM-RPC27686-20UG,BIM-RPC27686-100UG,BIM-RPC27686-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Reptile
Conjugation: Unconjugated
Alternative Names: Cardiotoxin 1A, Cardiotoxin 2, CTX-2, Cardiotoxin A2, CTX A2, Cardiotoxin II, Cardiotoxin analog II
Recombinant Naja atra Cytotoxin 2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Naja atra (Chinese cobra). Target Name: Naja atra Cytotoxin 2. Target Synonyms: Cardiotoxin 1A, Cardiotoxin 2, CTX-2, Cardiotoxin A2, CTX A2, Cardiotoxin II, Cardiotoxin analog II. Accession Number: P01442. Expression Region: 22~81aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 14.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 14.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Target: Naja atra Cytotoxin 2