Recombinant Glycine max Leghemoglobin C2, Unconjugated, E. coli

Catalog Number: BIM-RPC27688
Article Name: Recombinant Glycine max Leghemoglobin C2, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27688
Supplier Catalog Number: RPC27688
Alternative Catalog Number: BIM-RPC27688-20UG,BIM-RPC27688-100UG,BIM-RPC27688-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Leghemoglobin C2
Recombinant Glycine max Leghemoglobin C2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida). Target Name: Glycine max Leghemoglobin C2. Target Synonyms: Leghemoglobin C2. Accession Number: P02236. Expression Region: 2~145aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF
Target: Glycine max Leghemoglobin C2