Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1), Unconjugated, E. coli

Catalog Number: BIM-RPC27689
Article Name: Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27689
Supplier Catalog Number: RPC27689
Alternative Catalog Number: BIM-RPC27689-20UG,BIM-RPC27689-100UG,BIM-RPC27689-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: 20 kDa protein (Protein BCRF1, vIL-10)
Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Epstein-Barr virus(strain B95-8)(HHV-4)(Human herpesvirus 4). Target Name: BCRF1. Target Synonyms: 20 kDa protein (Protein BCRF1, vIL-10). Accession Number: P03180. Expression Region: 24~170aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: TDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR
Target: BCRF1