Recombinant Legionella pneumophila Aspartate-semialdehyde dehydrogenase (asd), Unconjugated, E. coli

Catalog Number: BIM-RPC27701
Article Name: Recombinant Legionella pneumophila Aspartate-semialdehyde dehydrogenase (asd), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27701
Supplier Catalog Number: RPC27701
Alternative Catalog Number: BIM-RPC27701-20UG,BIM-RPC27701-100UG,BIM-RPC27701-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Aspartate-beta-semialdehyde dehydrogenase
Recombinant Legionella pneumophila Aspartate-semialdehyde dehydrogenase (asd) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella pneumophila. Target Name: asd. Target Synonyms: Aspartate-beta-semialdehyde dehydrogenase. Accession Number: O31219. Expression Region: 1~347aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 41.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSRHLNVAIVGATGAVGETFLTVLEERNFPIKSLYPLASSRSVGKTVTFRDQELDVLDLAEFDFSKVDLALFSAGGAVSKEYAPKAVAAGCVVVDNTSCFRYEDDIPLVVPGSESSSNRDYTKRGIIANPNCSTIQMVVALKPIYDAVGISRINVATYQSVSGTGKKAISELVAQVGDLLNGRPANVQVYPQQIAFNALPHIDQFEDNGYTREEMKMVWETRKIMEDDSIMVNPTAVRVPVIYGHSEAVHLELKK
Target: asd