Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27721
Article Name: Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27721
Supplier Catalog Number: RPC27721
Alternative Catalog Number: BIM-RPC27721-20UG,BIM-RPC27721-100UG,BIM-RPC27721-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: L-ascorbate peroxidase 1b, APX1b, AtAPx02
Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: APX2. Target Synonyms: L-ascorbate peroxidase 1b, APX1b, AtAPx02. Accession Number: Q1PER6. Expression Region: 4~250aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 31.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 31.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK
Target: APX2