Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27737
Article Name: Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27737
Supplier Catalog Number: RPC27737
Alternative Catalog Number: BIM-RPC27737-20UG,BIM-RPC27737-100UG,BIM-RPC27737-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180, Breast cancer-associated antigen BRCAA1, Histone deacetylase complex subunit SAP180, Retinoblastoma-binding protein 1-like 1, ARID domain-containing protein 4B, BRCAA1, RBBP1L1, RBP1L1, SAP180)
Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ARID4B. Target Synonyms: 180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180, Breast cancer-associated antigen BRCAA1, Histone deacetylase complex subunit SAP180, Retinoblastoma-binding protein 1-like 1, ARID domain-containing protein 4B. Accession Number: Q4LE39. Expression Region: 167~415aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK
Target: ARID4B