Recombinant Arabidopsis thaliana E3 SUMO-protein ligase SIZ1 (SIZ1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27741
Article Name: Recombinant Arabidopsis thaliana E3 SUMO-protein ligase SIZ1 (SIZ1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27741
Supplier Catalog Number: RPC27741
Alternative Catalog Number: BIM-RPC27741-20UG,BIM-RPC27741-100UG,BIM-RPC27741-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: E3 SUMO-protein transferase SIZ1
Recombinant Arabidopsis thaliana E3 SUMO-protein ligase SIZ1 (SIZ1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: SIZ1. Target Synonyms: E3 SUMO-protein transferase SIZ1. Accession Number: Q680Q4. Expression Region: 1~171aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTVAKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRAD
Target: SIZ1