Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27746
Article Name: Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27746
Supplier Catalog Number: RPC27746
Alternative Catalog Number: BIM-RPC27746-20UG,BIM-RPC27746-100UG,BIM-RPC27746-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: ETF-related factor 2, ETFR-2, TEA domain family member 4, TEAD-4, TEF-1-related factor 1, TEF-1-related factor FR-19, RTEF-1
Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Tead4. Target Synonyms: ETF-related factor 2, ETFR-2, TEA domain family member 4, TEAD-4, TEF-1-related factor 1, TEF-1-related factor FR-19, RTEF-1. Accession Number: Q62296. Expression Region: 210~427aa. Tag Info: Tag-Free. Theoretical MW: 25.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.7kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Target: Tead4