Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27749
Article Name: Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27749
Supplier Catalog Number: RPC27749
Alternative Catalog Number: BIM-RPC27749-20UG,BIM-RPC27749-100UG,BIM-RPC27749-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Fibronectin type III domain containing 6 (FNDC6, IL-20 receptor subunit beta, IL-20R-beta, IL-20RB, IL-20R2, DIRS1)
Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IL20RB. Target Synonyms: Fibronectin type III domain containing 6 (FNDC6, IL-20 receptor subunit beta, IL-20R-beta, IL-20RB, IL-20R2, DIRS1). Accession Number: Q6UXL0. Expression Region: 30~233aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL
Target: IL20RB