Recombinant Human Beta-defensin 128 (DEFB128), Unconjugated, E. coli

Catalog Number: BIM-RPC27761
Article Name: Recombinant Human Beta-defensin 128 (DEFB128), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27761
Supplier Catalog Number: RPC27761
Alternative Catalog Number: BIM-RPC27761-20UG,BIM-RPC27761-100UG,BIM-RPC27761-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Beta-defensin 28Defensin, beta 128
Recombinant Human Beta-defensin 128 (DEFB128) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DEFB128. Target Synonyms: Beta-defensin 28Defensin, beta 128. Accession Number: Q7Z7B8. Expression Region: 19~93aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 16.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV
Target: DEFB128