Recombinant Human Complement decay-accelerating factor (CD55), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC28748
Article Name: Recombinant Human Complement decay-accelerating factor (CD55), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28748
Supplier Catalog Number: RPC28748
Alternative Catalog Number: BIM-RPC28748-20UG,BIM-RPC28748-100UG,BIM-RPC28748-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Complement decay-accelerating factor(CD antigen CD55)
Recombinant Human Complement decay-accelerating factor (CD55), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CD55. Target Synonyms: Complement decay-accelerating factor(CD antigen CD55). Accession Number: P08174. Expression Region: 35~126aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 45.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 45.4kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE
Target: CD55