Recombinant Rat Mannose-binding protein C (Mbl2), Unconjugated, E. coli

Catalog Number: BIM-RPC28754
Article Name: Recombinant Rat Mannose-binding protein C (Mbl2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28754
Supplier Catalog Number: RPC28754
Alternative Catalog Number: BIM-RPC28754-20UG,BIM-RPC28754-100UG,BIM-RPC28754-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Mannose-binding protein C(MBP-C, Mannan-binding protein, Ra-reactive factor polysaccharide-binding component p28A, RaRF p28A)
Recombinant Rat Mannose-binding protein C (Mbl2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Mbl2. Target Synonyms: Mannose-binding protein C(MBP-C, Mannan-binding protein, Ra-reactive factor polysaccharide-binding component p28A, RaRF p28A). Accession Number: P08661. Expression Region: 19~244aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.0kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD
Target: Mbl2