Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC28761
Article Name: Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC28761
Supplier Catalog Number: RPC28761
Alternative Catalog Number: BIM-RPC28761-20UG,BIM-RPC28761-100UG,BIM-RPC28761-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rabbit
Conjugation: Unconjugated
Alternative Names: Tumor necrosis factor ligand superfamily member 4(OX40 ligand, OX40L, CD antigen CD252)
Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus). Target Name: TNFSF4. Target Synonyms: Tumor necrosis factor ligand superfamily member 4(OX40 ligand, OX40L, CD antigen CD252). Accession Number: O02765. Expression Region: 45~187aa. Tag Info: C-Terminal 6Xhis-Tagged And Myc-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.8kDa
Tag: C-Terminal 6Xhis-Tagged And Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Target: TNFSF4