Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD), Unconjugated, Yeast

Catalog Number: BIM-RPC28762
Article Name: Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC28762
Supplier Catalog Number: RPC28762
Alternative Catalog Number: BIM-RPC28762-20UG,BIM-RPC28762-100UG,BIM-RPC28762-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Formimidoyltransferase-cyclodeaminase(Formiminotransferase-cyclodeaminase, FTCD, LCHC1) [Includes: Glutamate formimidoyltransferase(EC 2.1.2.5, Glutamate formiminotransferase, Glutamate formyltransferase), Formimidoyltetrahydrofolate cyclodeaminase(EC 4.3.1.4, Formiminotetrahydrofolate cyclodeaminase)]
Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FTCD. Target Synonyms: Formimidoyltransferase-cyclodeaminase(Formiminotransferase-cyclodeaminase, FTCD, LCHC1) [Includes: Glutamate formimidoyltransferase(EC 2.1.2.5, Glutamate formiminotransferase, Glutamate formyltransferase), Formimidoyltetrahydrofolate cyclodeaminase(EC 4.3.1.4. Accession Number: O95954. Expression Region: 1~541aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 60kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 60kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCR
Target: FTCD