Recombinant Mouse Apolipoprotein E (Apoe), Unconjugated, Yeast

Catalog Number: BIM-RPC28771
Article Name: Recombinant Mouse Apolipoprotein E (Apoe), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC28771
Supplier Catalog Number: RPC28771
Alternative Catalog Number: BIM-RPC28771-20UG,BIM-RPC28771-100UG,BIM-RPC28771-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: ApoeApolipoprotein E, Apo-E
Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Apoe. Target Synonyms: ApoeApolipoprotein E, Apo-E. Accession Number: P08226. Expression Region: 19~311aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKG
Target: Apoe