Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), Unconjugated, E. coli

Catalog Number: BIM-RPC28776
Article Name: Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28776
Supplier Catalog Number: RPC28776
Alternative Catalog Number: BIM-RPC28776-20UG,BIM-RPC28776-100UG,BIM-RPC28776-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: NTEF-1Protein GT-IICTEA domain family member 1
Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TEAD1. Target Synonyms: NTEF-1Protein GT-IICTEA domain family member 1. Accession Number: P28347. Expression Region: 1~426aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 51.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLE
Target: TEAD1