Recombinant Human Palmitoleoyl-protein carboxylesterase NOTUM (NOTUM), Unconjugated, E. coli

Catalog Number: BIM-RPC31096
Article Name: Recombinant Human Palmitoleoyl-protein carboxylesterase NOTUM (NOTUM), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31096
Supplier Catalog Number: RPC31096
Alternative Catalog Number: BIM-RPC31096-20UG,BIM-RPC31096-100UG,BIM-RPC31096-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: hNOTUM
Recombinant Human Palmitoleoyl-protein carboxylesterase NOTUM (NOTUM) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Palmitoleoyl-protein carboxylesterase NOTUM (NOTUM) . Accession Number: Q6P988, NOTUM. Expression Region: 20-496aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 57.8kda. Target Synonyms: hNOTUM Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 57.8kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >85% by SDS-PAGE
Sequence: SEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQY
Target: Palmitoleoyl-protein carboxylesterase NOTUM (NOTUM)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL