Recombinant Macaca mulatta Somatotropin (GH1), Unconjugated, E. coli

Catalog Number: BIM-RPC31100
Article Name: Recombinant Macaca mulatta Somatotropin (GH1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31100
Supplier Catalog Number: RPC31100
Alternative Catalog Number: BIM-RPC31100-20UG,BIM-RPC31100-100UG,BIM-RPC31100-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Monkey
Conjugation: Unconjugated
Alternative Names: Growth hormone, GH, GH-N, Growth hormone 1, Pituitary growth hormone
Recombinant Macaca mulatta Somatotropin (GH1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: Somatotropin (GH1) . Accession Number: P33093, Gh1. Expression Region: 27-217aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 29.7kda. Target Synonyms: Growth hormone, GH, GH-N, Growth hormone 1, Pituitary growth hormone Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.7kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNNDALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF
Target: Somatotropin (GH1)