Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31116
Article Name: Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31116
Supplier Catalog Number: RPC31116
Alternative Catalog Number: BIM-RPC31116-20UG,BIM-RPC31116-100UG,BIM-RPC31116-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: CD antigen CD277
Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Butyrophilin subfamily 3 member A1 (BTN3A1) . Accession Number: O00481, BTN3A1. Expression Region: 30-254aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 30.2kda. Target Synonyms: CD antigen CD277 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.2kDa
Tag: N-Terminal 10xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Target: Butyrophilin subfamily 3 member A1 (BTN3A1)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL