Recombinant Human Desert hedgehog protein (DHH), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31126
Article Name: Recombinant Human Desert hedgehog protein (DHH), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31126
Supplier Catalog Number: RPC31126
Alternative Catalog Number: BIM-RPC31126-20UG,BIM-RPC31126-100UG,BIM-RPC31126-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: DHH, HHG-3
Recombinant Human Desert hedgehog protein (DHH), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Desert hedgehog protein (DHH) . Accession Number: O43323, DHH. Expression Region: 51-158AA. Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged. Theoretical MW: 42.6kda. Target Synonyms: DHH, HHG-3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.6kDa
Tag: N-Terminal 10xHis-GST-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK
Target: Desert hedgehog protein (DHH)