Recombinant Adeno-associated virus 2 Protein Rep78 (Rep78), Unconjugated, E. coli

Catalog Number: BIM-RPC31135
Article Name: Recombinant Adeno-associated virus 2 Protein Rep78 (Rep78), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31135
Supplier Catalog Number: RPC31135
Alternative Catalog Number: BIM-RPC31135-20UG,BIM-RPC31135-100UG,BIM-RPC31135-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Recombinant Adeno-associated virus 2 Protein Rep78 (Rep78) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2). Target Name: Protein Rep78 (Rep78) . Accession Number: Q89268, Rep78. Expression Region: 1-621aa. Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged. Theoretical MW: 114.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 114.3kDa
Tag: N-Terminal MBP-Tagged and C-Terminal 6xHis-Tagged
Purity: >85% by SDS-PAGE
Sequence: MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNA
Target: Protein Rep78 (Rep78)