Recombinant Bacteroides fragilis Biotin biosynthesis bifunctional protein BioAB (bioB), Unconjugated, E. coli
Catalog Number:
BIM-RPC31159
| Article Name: |
Recombinant Bacteroides fragilis Biotin biosynthesis bifunctional protein BioAB (bioB), Unconjugated, E. coli |
| Biozol Catalog Number: |
BIM-RPC31159 |
| Supplier Catalog Number: |
RPC31159 |
| Alternative Catalog Number: |
BIM-RPC31159-20UG,BIM-RPC31159-100UG,BIM-RPC31159-1MG |
| Manufacturer: |
Biomatik Corporation |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Bacteria |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Biotin synthase BioB, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase BioA, 7,8-diamino-pelargonic acid aminotransferase, DAPA AT, DAPA aminotransferase, 7,8-diaminononanoate synthase, DANS, Diaminopelargonic acid synthase |
| Recombinant Bacteroides fragilis Biotin biosynthesis bifunctional protein BioAB (bioB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow). Target Name: Biotin biosynthesis bifunctional protein BioAB (bioB) . Accession Number: Q5LEY1, bioB. Expression Region: 1-748aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 90.6kda. Target Synonyms: Biotin synthase BioB, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase BioA, 7,8-diamino-pelargonic acid aminotransferase, DAPA AT, DAPA aminotransferase, 7,8-diaminononanoate synthase, DANS, Diaminopelargonic acid synthase Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
| Molecular Weight: |
90.6kDa |
| Tag: |
N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged |
| Purity: |
>85% by SDS-PAGE |
| Sequence: |
MTIEEIKNQVLQGTAISREQAEWLALYPRKEELYDAAHDITTACASQEFDMCSIINARSGRCPENCKWCAQSSHYKTKADVYDLVSADECLRQAKYNEAQGVNRFSLVTSGRKPSPKNMKELCVAARRMRRHSSIRLCASLGLLDEEELQALYDAGVTRYHCNLETAPSHFDSLCTTHTQEQKLKTLHAARRVGMDLCCGGIIGMGETVEQRIEFAFTLRDLNIQSIPINLLQPIPGTPLEHQSPLSEEEILTTV |
| Target: |
Biotin biosynthesis bifunctional protein BioAB (bioB) |
