Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1), Unconjugated, E. coli

Catalog Number: BIM-RPC31189
Article Name: Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31189
Supplier Catalog Number: RPC31189
Alternative Catalog Number: BIM-RPC31189-20UG,BIM-RPC31189-100UG,BIM-RPC31189-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Collagen triple helix repeat-containing protein 1 (Cthrc1) . Accession Number: Q9D1D6, Cthrc1. Expression Region: 33-245aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 36.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.0kDa
Tag: N-Terminal 6xHis-SUMO-Tagged
Purity: >90% by SDS-PAGE
Sequence: SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Target: Collagen triple helix repeat-containing protein 1 (Cthrc1)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL