Recombinant Human Anoctamin-5 (ANO5), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31190
Article Name: Recombinant Human Anoctamin-5 (ANO5), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31190
Supplier Catalog Number: RPC31190
Alternative Catalog Number: BIM-RPC31190-20UG,BIM-RPC31190-100UG,BIM-RPC31190-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Gnathodiaphyseal dysplasia 1 protein, Transmembrane protein 16E
Recombinant Human Anoctamin-5 (ANO5), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Anoctamin-5 (ANO5) . Accession Number: Q75V66, ANO5. Expression Region: 1-299aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 42.9kda. Target Synonyms: Gnathodiaphyseal dysplasia 1 protein, Transmembrane protein 16E Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.9kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: MGDPDLLEVLAEEGEKVNKHIDYSFQMSEQSLSSRETSFLINEETMPAKRFNLFLRRRLMFQKNQQSKDSIFFRDGIRQIDFVLSYVDDVKKDAELKAERRKEFETNLRKTGLELEIEDKRDSEDGRTYFVKIHAPWEVLVTYAEVLGIKMPIKESDIPRPKHTPISYVLGPVRLPLSVKYPHPEYFTAQFSRHRQELFLIEDQATFFPSSSRNRIVYYILSRCPFGIEDGKKRFGIERLLNSNTYSSAYPLHDG
Target: Anoctamin-5 (ANO5)