Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3), partial, Unconjugated, E. coli
Catalog Number:
BIM-RPC31197
| Article Name: |
Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3), partial, Unconjugated, E. coli |
| Biozol Catalog Number: |
BIM-RPC31197 |
| Supplier Catalog Number: |
RPC31197 |
| Alternative Catalog Number: |
BIM-RPC31197-20UG,BIM-RPC31197-100UG,BIM-RPC31197-1MG |
| Manufacturer: |
Biomatik Corporation |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Virus |
| Conjugation: |
Unconjugated |
| Alternative Names: |
EBNA-3, EBV nuclear antigen 3, Epstein-Barr nuclear antigen 3A, EBNA-3A, EBV nuclear antigen 3A |
| Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). Target Name: Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3) . Accession Number: Q3KST2, EBNA3. Expression Region: 1-138aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 22.6kda. Target Synonyms: EBNA-3, EBV nuclear antigen 3, Epstein-Barr nuclear antigen 3A, EBNA-3A, EBV nuclear antigen 3A Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
| Molecular Weight: |
22.6kDa |
| Tag: |
N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged |
| Purity: |
>90% by SDS-PAGE |
| Sequence: |
MDKDRPGDPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAQLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA |
| Target: |
Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3) |
