Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31200
Article Name: Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31200
Supplier Catalog Number: RPC31200
Alternative Catalog Number: BIM-RPC31200-20UG,BIM-RPC31200-100UG,BIM-RPC31200-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: Milk growth factor, MGF
Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: Transforming growth factor beta-2 proprotein (TGFB2) . Accession Number: P21214, TGFB2. Expression Region: 303-414aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 20.2kda. Target Synonyms: Milk growth factor, MGF Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 20.2kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Target: Transforming growth factor beta-2 proprotein (TGFB2)