Recombinant Mouse Dipeptidyl peptidase 1 (Ctsc), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31222
Article Name: Recombinant Mouse Dipeptidyl peptidase 1 (Ctsc), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31222
Supplier Catalog Number: RPC31222
Alternative Catalog Number: BIM-RPC31222-20UG,BIM-RPC31222-100UG,BIM-RPC31222-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Cathepsin C, Cathepsin J, Dipeptidyl peptidase I, DPP-I, DPPI, Dipeptidyl transferase, Dipeptidyl peptidase I exclusion domain chain, Dipeptidyl peptidase I heavy chain, Dipeptidyl peptidase I light chain
Recombinant Mouse Dipeptidyl peptidase 1 (Ctsc), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Dipeptidyl peptidase 1 (Ctsc) . Accession Number: P97821, Ctsc. Expression Region: 25-134aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 20.1kda. Target Synonyms: Cathepsin C, Cathepsin J, Dipeptidyl peptidase I, DPP-I, DPPI, Dipeptidyl transferase, Dipeptidyl peptidase I exclusion domain chain, Dipeptidyl peptidase I heavy chain, Dipeptidyl peptidase I light chain Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 20.1kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNW
Target: Dipeptidyl peptidase 1 (Ctsc)