Recombinant Human Desmin (DES), Unconjugated, E. coli

Catalog Number: BIM-RPC31223
Article Name: Recombinant Human Desmin (DES), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31223
Supplier Catalog Number: RPC31223
Alternative Catalog Number: BIM-RPC31223-20UG,BIM-RPC31223-100UG,BIM-RPC31223-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Accession Number: P17661; DES. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-470aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Desmin (DES) is a purified Recombinant Protein
Molecular Weight: 80.5kDa
Tag: C-Terminal EGFP-Tagged
Purity: >85% by SDS-PAGE
Sequence: SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQ
Target: Desmin (DES)