Recombinant Human Transcription factor Jun (JUN), Unconjugated, E. coli

Catalog Number: BIM-RPC31235
Article Name: Recombinant Human Transcription factor Jun (JUN), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31235
Supplier Catalog Number: RPC31235
Alternative Catalog Number: BIM-RPC31235-20UG,BIM-RPC31235-100UG,BIM-RPC31235-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Activator protein 1, AP1, Proto-oncogene c-Jun, Transcription factor AP-1 subunit Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39
Recombinant Human Transcription factor Jun (JUN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Transcription factor Jun (JUN) . Accession Number: P05412, JUN. Expression Region: 1-331aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 43.1kda. Target Synonyms: Activator protein 1, AP1, Proto-oncogene c-Jun, Transcription factor AP-1 subunit Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 43.1kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKA
Target: Transcription factor Jun (JUN)