Recombinant Streptococcus mutans serotype c Glucosyltransferase-SI (gtfC), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31249
Article Name: Recombinant Streptococcus mutans serotype c Glucosyltransferase-SI (gtfC), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31249
Supplier Catalog Number: RPC31249
Alternative Catalog Number: BIM-RPC31249-20UG,BIM-RPC31249-100UG,BIM-RPC31249-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: GTF-SI, Dextransucrase, Sucrose 6-glucosyltransferase
Recombinant Streptococcus mutans serotype c Glucosyltransferase-SI (gtfC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus mutans serotype c (strain ATCC 700610 / UA159). Target Name: Glucosyltransferase-SI (gtfC) . Accession Number: P13470, gtfC. Expression Region: 426-597aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 26.7kda. Target Synonyms: GTF-SI, Dextransucrase, Sucrose 6-glucosyltransferase Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.7kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: TIGGYEFLLANDVDNSNPVVQAEQLNWLHFLMNFGNIYANDPDANFDSIRVDAVDNVDADLLQIAGDYLKAAKGIHKNDKAANDHLSILEAWSYNDTPYLHDDGDNMINMDNRLRLSLLYSLAKPLNQRSGMNPLITNSLVNRTDDNAETAAVPSYSFIRAHDSEVQDLIRN
Target: Glucosyltransferase-SI (gtfC)