Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5), Unconjugated, E. coli

Catalog Number: BIM-RPC31251
Article Name: Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31251
Supplier Catalog Number: RPC31251
Alternative Catalog Number: BIM-RPC31251-20UG,BIM-RPC31251-100UG,BIM-RPC31251-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Glandular kallikrein K5, mGK-5, Tissue kallikrein-5
Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Kallikrein 1-related peptidase b5 (Klk1b5) . Accession Number: P15945, Klk1b5. Expression Region: 25-261aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 39.1kda. Target Synonyms: Glandular kallikrein K5, mGK-5, Tissue kallikrein-5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 39.1kDa
Tag: N-Terminal 6xHis-SUMO-Tagged
Purity: >85% by SDS-PAGE
Sequence: IFGGFNCEKNSQPWQVAVYRFTKYQCGGVLLNANWVLTAAHCHNDKYQVWLGKNNFFEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVIYEPADDLQCVNFKLLPNEDCVKAHIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGVLHGITSWGPSPCGKPNVPGIYTKLIKFNSWIKDTIAKNA
Target: Kallikrein 1-related peptidase b5 (Klk1b5)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL